SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6K694 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6K694
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-34
Family spliceosomal protein U5-15Kd 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6K694
Sequence length 142
Comment (tr|B6K694|B6K694_SCHJY) U4/U6 X U5 tri-snRNP complex subunit Dim1 {ECO:0000313|EMBL:EEB09048.1} KW=Complete proteome; Reference proteome OX=402676 OS=yeast). GN=SJAG_04222 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSYLLPHLHSGWHVDQAILSEQERLVVIRFGRDHDEECMKQDEVLYKVAEKVSNFAVIYL
VDIDEVPDFNKMYELYDRTTIMFFYRNKHMMVDLGTGNNNKINWALEDKQELIDIIETVY
RGARKGKGLVISPKDYSTRHRY
Download sequence
Identical sequences B6K694
XP_002175341.1.46972 SJAG_04222T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]