SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6V0D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6V0D8
Domain Number 1 Region: 43-259
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.06e-119
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000183
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 6.67e-18
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6V0D8
Sequence length 259
Comment (tr|B6V0D8|B6V0D8_9ARCH) Methyl coenzyme M reductase subunit alpha {ECO:0000313|EMBL:ACI48665.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSFISAYSMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGYLA
DIIQTSRISNDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNVY
YNVDYINDKYNGAANAGTDNKVKATLDVVKDIATESTLYGIETYEKFPTALEDHFGGSQR
ATVLAAAAGVATALATANANAGLSGWYLSMYLHKEAWGRLGFFGYDLQDQCGATNVLSYQ
GDEGLPDELRGPNYPNYAM
Download sequence
Identical sequences B6V0D8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]