SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6YRB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6YRB0
Domain Number 1 Region: 297-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000717
Further Details:      
 
Domain Number 2 Region: 13-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-40
Family Ribonuclease PH domain 1-like 0.0000835
Further Details:      
 
Domain Number 3 Region: 452-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 146-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-25
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 5 Region: 620-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.55e-18
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 6 Region: 559-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.35e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6YRB0
Sequence length 719
Comment (sp|B6YRB0|PNP_AZOPC) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome; Reference proteome OX=511995 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2. GN=CFPG_469; OC=Candidatus Azobacteroides.
Sequence
MINSIIKTIDLGDGRTITLETGKLAKQADGAIVLRMNNTMILATVCVAKDTNPCVDFLPL
QVEYKEKFSAFGRFPGGFTKREGRASDYEILTCRLIDRTLRPLFPRDYHSEVFVNIILFS
SDGEDIPDALAGLAASAALSVSTIPFNGPISEVRVARIDGKFKINPTFGELAKADMDIMV
GATADNIMMVEGEMNEVSEEEMLEAIKAAHEAIKPQCKAQIELARIVGTTIKNTYSHEVN
DEELRSDIKTKLYDKVYAVAKSGQCKNKRIEAFQTIIEEYKKQFKEKELSEEKIFLIKRY
YYEIEKEVMRRCILDENIRIDGRKTTEIRPIWSEVNPITGPHGSAIFTRGETQALATVTL
GTKLNEKIIDDVLINDKERFLLHYNFPPFATGEARAQRGIGRREIGHGNLAHRALKPIIP
NNYPYVIRVVSDILESNGSSSMATVCAGTLSLMDAGVQIKRPVSGIAMGLIFEKEGSKYA
ILSDILGDEDHLGDMDFKVAGTKKGITATQMDIKIDGLSYEVLERALSQAKQGREYILDK
MLETIPEPRTDLKPHTPKIEIIIIPKEFIGSVIGPGGKIIQRLQEETGTTITIEEIEKMG
RIEIFGDNKKSIDAALTRIKGIVSVPEVGEIYEGKIRSIMPYGAFIEFLPGKEGLLHISE
ISWKHLESIEEAGLNEGDFIKIKLVDIDSKTGKFKLSHKILLPHSEKYTAIRREQHEKI
Download sequence
Identical sequences B6YRB0
gi|212550826|ref|YP_002309143.1| 511995.CFPG_469 WP_012573493.1.38342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]