SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7E2K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7E2K2
Domain Number 1 Region: 90-318
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.33e-39
Family Nuclear receptor ligand-binding domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7E2K2
Sequence length 322
Comment (tr|B7E2K2|B7E2K2_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CCD74249.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_T27B7.4 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDASKFQYDRDAISAIKHPKIFPSVSYYVGRPEFLMFSDSNVTSQKTFIDVQNLVFEVSR
YLDHGCETPIYAENQLKKLTLGFKLMQFDYQNVKFFDKIGKAEFIDIIEYYFLTVAKWIA
HFDEFRKLDQSLQIKLLQAIWHVWSKIHKCASTAFYRKSNPNAKPTQKILRNVCMDRMHV
HKLDTSWMSDYPTEHVTRFMLTHHVYDFKIVESLLKLDPTDVELTFMFAQLCFEYAGKRF
QGEILKITDHFQQVLSNDLHHYYITDQRRERYFQRLTDLMKVNNLIQRSIWETRPHRELG
RVFEISKLEFSHPEMFDDSGFC
Download sequence
Identical sequences B7E2K2
NP_001256015.1.50509 T27B7.4b T27B7.4b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]