SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7FAU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7FAU8
Domain Number 1 Region: 23-90
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-24
Family GDI-like 0.0000588
Further Details:      
 
Domain Number 2 Region: 91-136
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.99e-17
Family GDI-like N domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7FAU8
Sequence length 149
Comment (tr|B7FAU8|B7FAU8_MOUSE) Rab GDP dissociation inhibitor {ECO:0000256|RuleBase:RU363124} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=RP23-436K3.9-007 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
KSEGEVARCKQLICDPSYIPDRVQKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNR
KSEPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIK
DIYKRMAGSAFDFENMKRKQNDVFGEADQ
Download sequence
Identical sequences B7FAU8
ENSMUSP00000122146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]