SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7FNJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7FNJ4
Domain Number 1 Region: 422-515
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-33
Family ets domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 245-344
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.1e-19
Family Pointed domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7FNJ4
Sequence length 518
Comment (tr|B7FNJ4|B7FNJ4_DROME) FI03841p {ECO:0000313|EMBL:ACK77599.1} OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Ets98B-RA OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEYEKMLYMPAASEMPHSPQLKPHQFQAHTPTDQYSSYADNFDLSLLPQESASIPTTVFQ
YNAPQIKVECAWDSQPIQQQQQPTAPYTNPSSHQLIPPPAYPHSAYPSPQSSPLQSEFAA
YGLGRFGGSYDSLNSPSPSLEAVSIKQELHILPPSPPESNCETPSPRSSCGESIKAEPLD
ADIESLIDLNSLLQQQSLQSPQNLQDTKPDHQLLRECLEDTSFQKRHNLKPLALESFIGG
LAEVRGDFEPVISLALEHAKREADAICAELQISQDPNGWSPAQVHAWLRSTLAQFRLPPV
ADLELHFCENGAALALLSEEEFVRRLPESGSTLHAQLEIWKMAYADQPAHQQHSQQSAST
DHWPASYAMPHLDLDYNEDSEDDDDMEADAQVAPLNGSTTSPPATNASNGGTATVKRPNG
GRTGGGGSHIHLWQFLKELLASPQVNGTAIRWIDRSKGIFKIEDSVRVAKLWGRRKNRPA
MNYDKLSRSIRQYYKKGIMKKTERSQRLVYQFCHPYSQ
Download sequence
Identical sequences B7FNJ4 P29775
7227.FBpp0084594 FBpp0084594 FBpp0084594 NP_524535.2.81976 FBpp0084594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]