SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7FUB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7FUB5
Domain Number - Region: 382-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0769
Family Laminin G-like module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7FUB5
Sequence length 554
Comment (tr|B7FUB5|B7FUB5_PHATC) Predicted protein {ECO:0000313|EMBL:EEC50231.1} KW=Complete proteome; Reference proteome OX=556484 OS=Phaeodactylum tricornutum (strain CCAP 1055/1). GN=PHATRDRAFT_44497 OC=Bacillariophycidae; Naviculales; Phaeodactylaceae; Phaeodactylum.
Sequence
MIACIRRTQSQNTAEIIQPDYESMVGETFCVAWFHPGGVQEVDVALNVKDDVYVAELGDA
FPTNISSQSRTQLKRDIDAPSRRDEVESQIVHNQGPPSMLPIRKDTLFVLLSGKAISFGY
TKGFLMDVFRLAMQENDAEDVGFLNTHINLSSPYSPTFAVRGAVVARPESYCMCVLSEGR
SNSETEEDESNGELILIQQQEAQISRFCRQQRNCELRREVLPRVIQPSPFTVGRKQRCVQ
FLNAKGSHAVCMMTPPFDCGPVEGPITIFIIGIATEDGCFVSGLYHRFELGHLHPEDSTI
EETEMSPVCMATSLYAAQYIEDTGSPVSYSLNSYNDERSSSNHSSGESISKCNCVMQGST
EKLACTAELEDDAQIVRGKSGPGRWHCYTFVADGCESSIRIDGVPEPMSIQIGTEIRRRE
VLDGLTIGSDHCFNVSLCCGHGSGGEGEGAIAEIAVFRGILDPLDVQTLEHRLMIKHGIP
RPSGVLWNETNFERYAHALYTDPRAPQWTEHVPLRFMARHRSVAWSQRNPVTGRNMQISK
IGCHASVESSDWDD
Download sequence
Identical sequences B7FUB5
2850.JGI44497 XP_002178566.1.39622 jgi|Phatr2|44497|estExt_fgenesh1_pg.C_chr_40304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]