SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7IHG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7IHG5
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.4e-63
Family CbiG N-terminal domain-like 0.0000981
Further Details:      
 
Domain Number 2 Region: 203-318
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.88e-28
Family CobE/GbiG C-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7IHG5
Sequence length 330
Comment (tr|B7IHG5|B7IHG5_THEAB) CbiG {ECO:0000313|EMBL:ACJ75529.1} KW=Complete proteome; Reference proteome OX=484019 OS=Thermosipho africanus (strain TCF52B). GN=THA_1073 OC=Thermosipho.
Sequence
MKIAILSITKNGAELSKRLFNSIKCDVYVKEDFKFNGAKVIDFLLKRFVKKIFKMYDALV
FIMATGIVVRVIADCLKDKFDDPAVVVIDEKGNFVISLLSGHVGGANELAKRLSKILDAV
PVITTASDVNGIESIDMIAKRYGFEIERREDLSKVSAAIVNKEHVDFILDSELDIDVESK
SYIDSTAQVYITNKVVFSKKPHVILRPKNLVVGIGCKKNIQIKKLLQFVESSLVFLNLSK
NSIRAIATIELKKKEDALLKLSKYLNVPLKIYSVEDIKKVESLFEGSEFVKKIIGVGSVA
RPVGYLESNMGKELFYSKKDGMVLSIYQDR
Download sequence
Identical sequences B7IHG5
484019.THA_1073 WP_012579979.1.97851 gi|217077154|ref|YP_002334870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]