SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7K6B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7K6B5
Domain Number 1 Region: 241-295
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000392
Family Cold shock DNA-binding domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7K6B5
Sequence length 299
Comment (tr|B7K6B5|B7K6B5_CYAP8) Uncharacterized protein {ECO:0000313|EMBL:ACK68168.1} KW=Complete proteome; Reference proteome OX=41431 OS=RF-1)). GN=PCC8801_4244 OC=Cyanothecaceae; Cyanothece.
Sequence
MTQDQKLTRIGIFYDGNYFLHVSNYYNYNHERKARVSIPGLHEFIRHQVAKEEGVDVRLC
QIVDAHYFRGRLSAGEASRNQLYYDRVFDDILMSEGVITHYLPLRTWGGKMEEKGIDVWL
ALEAFELAFYKRFSVLVLIACDGDYVPLVRKLNTLGTRVMVLSWDFNYINEYGDERITRT
SQDLLEEVTYPVAMHEIIDNRINRNDALINNLFASPKSSNKEFAVPPKTFSSEKSEIISL
QPGGYGFIKYPPNNLFFHFTDLVDVDFNDLEKGMKVEFSRGTNDRGETVAKNVKPLLDT
Download sequence
Identical sequences B7K6B5
WP_015785222.1.62203 WP_015785222.1.93053 gi|257062039|ref|YP_003139927.1| 395962.Cyan8802_4306 41431.PCC8801_4244 gi|218248953|ref|YP_002374324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]