SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7KA91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7KA91
Domain Number 1 Region: 28-130
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000267
Family Lipase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7KA91
Sequence length 259
Comment (tr|B7KA91|B7KA91_CYAP7) Uncharacterized protein {ECO:0000313|EMBL:ACK72865.1} KW=Complete proteome; Reference proteome OX=65393 OS=29155)). GN=PCC7424_4501 OC=Cyanothecaceae; Cyanothece.
Sequence
MNWQEFSGSWVLIPQHPIGVIHFLGGAFVGTAPNLTYRWLLENLGKSGYAIITTPFVNTL
DHTAIARSVLNRFETILERLQTTNALGQRYLPIYGLGHSMGCKLHLLIGSMFSVERAGNI
LISYNNYPIRRAIPLIEQLQIDKTFQLEFVPSPEETNVLIAKNYAIRRNLLIRFTNDEID
QTSLLSPVLEQRFPQMVAFLTLTGNHLTPLGQDIEWQMGEVFSPFDALGQWVKQSLSRDL
YALKQEIVRWLNPLDFQKK
Download sequence
Identical sequences B7KA91
WP_015956449.1.63236 65393.PCC7424_4501 gi|218441404|ref|YP_002379733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]