SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7LQ00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7LQ00
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.49e-21
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7LQ00
Sequence length 193
Comment (tr|B7LQ00|B7LQ00_ESCF3) Putative esterase {ECO:0000313|EMBL:CAQ90465.1} KW=Complete proteome OX=585054 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73). GN=EFER_2972 OC=Enterobacteriaceae; Escherichia.
Sequence
MSTLLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPSDAAELLESIVLEHGG
DSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVKPFELLTDYLGQNENPYTGQQYVLESR
HIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDY
FNPIVDFLGLHNF
Download sequence
Identical sequences B7LQ00 F0JQG6
WP_000105732.1.24170 WP_000105732.1.31509 WP_000105732.1.42880 WP_000105732.1.5512 WP_000105732.1.80724 WP_000105732.1.97160 gi|218550280|ref|YP_002384071.1| 585054.EFER_2972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]