SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7MPC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7MPC2
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.03e-83
Family Hypothetical esterase YJL068C 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7MPC2
Sequence length 277
Comment (tr|B7MPC2|B7MPC2_ECO81) S-formylglutathione hydrolase {ECO:0000256|RuleBase:RU363068} KW=Complete proteome OX=585397 OS=Escherichia coli O81 (strain ED1a). GN=ECED1_0383 OC=Enterobacteriaceae; Escherichia.
Sequence
MELIEKHASFGGWQNVYRHYSPSLKCEMNVGVYLPPKAENEKLPVLYWLSGLTCNEQNFI
TKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYLNATQAPWNEHYKMYDY
IRNELPNLVMHHFPATARKSISGHSMGGLGALVLALRNPDEYASVSAFSPIVSPSQVPWG
QQAFAAYLGENKDAWLDYDPVSLISQGQRVAEIMVDQGLSDDFYAEQLRTPNLEKICQEM
NIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR
Download sequence
Identical sequences A0A0V9RJL0 B7MPC2
WP_000419040.1.11519 WP_000419040.1.13181 WP_000419040.1.16608 WP_000419040.1.20818 WP_000419040.1.23021 WP_000419040.1.23686 WP_000419040.1.28500 WP_000419040.1.35253 WP_000419040.1.4610 WP_000419040.1.47024 WP_000419040.1.585 WP_000419040.1.62043 WP_000419040.1.66421 WP_000419040.1.69438 WP_000419040.1.75087 WP_000419040.1.76469 WP_000419040.1.83125 WP_000419040.1.83911 WP_000419040.1.95449 WP_000419040.1.99472 585397.ECED1_0383 gi|218688226|ref|YP_002396438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]