SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7MPJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7MPJ2
Domain Number 1 Region: 12-253
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.32e-50
Family Haloperoxidase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7MPJ2
Sequence length 254
Comment (tr|B7MPJ2|B7MPJ2_ECO81) Putative esterase {ECO:0000313|EMBL:CAR06874.1} KW=Complete proteome OX=585397 OS=Escherichia coli O81 (strain ED1a). GN=ECED1_0668 OC=Enterobacteriaceae; Escherichia.
Sequence
MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNNHNIIQVDMRNHGLSPRDP
VMNYPAMAQDLVDILDAQQIDKATFIGHSMGGKAVMALTALAPDRIDKLVAIDIAPVDYH
VRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWD
QYPHIVGWEKIPAWDHPILFIPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEK
PDAVLRAIRRYLND
Download sequence
Identical sequences B7MPJ2
gi|218688493|ref|YP_002396705.1| WP_000773305.1.35253 585397.ECED1_0668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]