SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7P1H0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7P1H0
Domain Number 1 Region: 116-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7P1H0
Sequence length 177
Comment (tr|B7P1H0|B7P1H0_IXOSC) Uncharacterized protein (Fragment) {ECO:0000313|VectorBase:ISCW015833-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW015833 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
EEEDLCTEFFQKQLNKSNGMYVCQKVGDNYLFKCRDGLFSYNEVTSGRLTRWSCADKRED
IPLASSESPKLVTDKEPQPGTEGNVTKNTPVPDVTDKEPQTGTEGTVTKTTPVSDDPCSP
SPCVNGGVCKPGTGKTFTCECPKGFKGNLCEEKNSGVSVQAPVTAILGIAMSLLLLL
Download sequence
Identical sequences B7P1H0
XP_002433378.1.51680 ISCW015833-PA 6945.ISCW015833-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]