SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7P5R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7P5R8
Domain Number 1 Region: 292-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.067
Further Details:      
 
Weak hits

Sequence:  B7P5R8
Domain Number - Region: 103-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00106
Family APC10-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7P5R8
Sequence length 364
Comment (tr|B7P5R8|B7P5R8_IXOSC) Netrin, putative {ECO:0000313|EMBL:EEC01940.1, ECO:0000313|VectorBase:ISCW016329-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW016329 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MRAARSALVSLLPLLLAAAAARTGGNVGNAYLASMFAAQTQSDPCYDDMNNPRRCIPDFV
NAAFGKEVRTSSECGTPPSRYCNTATDDKGEIVRNCQICDAGNPKRRHPASYLTDLNNPN
NVTCWMSEPFPQPLYNVSLILSLGKKYELTYISLQFCGAKPDSLAVYKSTDYGKSWQPFQ
FYSSQCRKMYGRQNRALITKANEQEPLCTDPQSTTEQLSGARIAFSTLEGRPSAYEFDSS
PVLQEWVTATDVKVVFNRLTNWTPEPLDNDTLVPREASLYYAVSDFAVGGRCKCNGHGSR
CVQNRDGQLACECKHNTAGRDCEKCKPFHFDRPWGRATAHDAHECVREYPEFIPLPVCGS
ECCQ
Download sequence
Identical sequences B7P5R8
XP_002407808.1.51680 6945.ISCW016329-PA ISCW016329-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]