SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PBI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PBI2
Domain Number 1 Region: 124-399
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.03e-22
Family Galacturonase 0.057
Further Details:      
 
Domain Number 2 Region: 375-525
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.51e-20
Family Pectate lyase-like 0.086
Further Details:      
 
Domain Number 3 Region: 557-695
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.55e-18
Family Pectate lyase-like 0.068
Further Details:      
 
Domain Number 4 Region: 14-97
Classification Level Classification E-value
Superfamily F-box domain 1.44e-17
Family F-box domain 0.002
Further Details:      
 
Weak hits

Sequence:  B7PBI2
Domain Number - Region: 703-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0565
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7PBI2
Sequence length 796
Comment (tr|B7PBI2|B7PBI2_IXOSC) F-box containing protein, putative {ECO:0000313|EMBL:EEC03954.1, ECO:0000313|VectorBase:ISCW003305-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW003305 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MYEGGGGAHYLLYEVPDEVLLTIFSYLLEQDLCRAAQVCRRFHTISSDTELWKSLYQSVY
EYDLPLFHPAPCKFEFVAPEEADCSNPWKESFRQLYRGIHVRPHFQAQYDGHPQRYRGRS
LSYFDTIETAFNYCEELEQPVIFVHTGTYKGEFLIVDAGVALIGAAPGNVAEHVVLERDT
DSTITFVEGARGAYLGYMTLKFTPDITSSVPHHKHYCLEINENCSPTVDHCIIRSTSVVG
AAVCVSGAGAEPCLRSCDISDCENVGLYITDYAQGIYEENEISRNALAGVWVKNHANPIM
RRNHIHHGRDVGVFTFDNGLGYFEANDIHNNRIAGFEVKAGANPTVVRCEIHHGQTGGIY
VHENGRGQFIENKIHSNNFAGVWITSHSNPTIRRNDIYNGHQGGVYIFGEGRGLIEHNNI
HGNALAGIQIRTNSDPIVRYNKIHHGQHGGIYVHEKGQGLIEENEVYANTLAGVWITTGS
TPVLRRNRIHSGKQVGVYFYDNGHGRLEENDIFNHLYSGVQISGLPRTLNRLSPVSPGLA
ATPSSGATRSGEARTGASWVYNGGLGVLEQNEIFDNAMAGVWIKTDSNPTLRRNKIYDGR
DGGVCIFNGGKGVLEENDIFRNAQAGVLISTQSHPVLRRNRIFDGLAAGVEITNNATATL
EFNQIFNNRFGGLCLASGVQPILKGNRIFDNHNAVEKAVNSGQCLYKISSYTSFPMHDFY
RCKTCNTTDRNAICVNCIKTCHSGHDVEFIRHDRFFCDCGAGTLSNQCQLQGEPTQDTDT
LYDSAAPMESHTLLVN
Download sequence
Identical sequences B7PBI2
6945.ISCW003305-PA XP_002408176.1.51680 ISCW003305-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]