SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PCN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PCN4
Domain Number 1 Region: 351-409
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000135
Family Variant RING domain 0.01
Further Details:      
 
Weak hits

Sequence:  B7PCN4
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00778
Family Integrin beta EGF-like domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7PCN4
Sequence length 472
Comment (tr|B7PCN4|B7PCN4_IXOSC) Uncharacterized protein (Fragment) {ECO:0000313|VectorBase:ISCW002131-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW002131 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
NCSGHGECHQGICFCEVQYSGGTCTDPNISYFVAFSTIFYLICAVSFVQLLICIRSEFSR
IKPPSLLKALKVTTQKALYALICIATFARGFYFSSPENASLDWASSLMSAYYPLLLTGSS
LIVCFWAEVFHLRDLRHDKPRFLSKSFLGFLAFNIITYSLLLAELVLIQFAGYGETERVS
FFTFCTVVLSRSVVGWGNFSPLFYGKLCEILPPSVLQVRGAFVAGPPSAPNMSQVHQSRL
GLVAFAILLLTTVLFILSDVMGSFWKDKVAVLGRNCHDVMFRVIEMGLALWFPCVLWNCV
QPQQLWILNPKKLLVRREPDKTPPTGPESEALFSVPKELAKSGGDSLEKLPECFICYDSD
RTDAGPLIRPCNCKGDVSVVHHDCLRTWLIESAGNADSNRCKVCNEEYELERGEVWLPSG
LSPAHWLQTAAVLVIMGSAVSGACLVVKVFDNVGIRTLAVGLALLAEYVCLR
Download sequence
Identical sequences B7PCN4
ISCW002131-PA 6945.ISCW002131-PA XP_002410054.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]