SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PDZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PDZ4
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 98-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000396
Family I set domains 0.041
Further Details:      
 
Weak hits

Sequence:  B7PDZ4
Domain Number - Region: 197-286
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000176
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7PDZ4
Sequence length 326
Comment (tr|B7PDZ4|B7PDZ4_IXOSC) Uncharacterized protein (Fragment) {ECO:0000313|VectorBase:ISCW018183-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW018183 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
PPRVTLQLGKGLREPVIEEGRDLYFECVVRANPAASLVQWFHNGASLEPAANGTSGLLST
GRYLVVRHVRATQAGTYSCSAHNALATTESNSVLLTVQYIPRCQKIWSSTSSNGTETTVS
CQVASVPEDVSFAWTVRDGSQGERVVDDADVWVNGSLSALTVSHASHGVVGDVTLYCRAR
NLLGLQRSPCVMAVDTRQKPGVLRDCSVSNQSDDRLLVSCSHADPHPGDRFLLEVQTAAK
LSFSVTRETPSFWIPSLEPGVESLLLLYVVNDRGGRGEPLKLTVHTDPYTAPLASADKRP
SSALGTSALLGLVMASLSAMLLAPTR
Download sequence
Identical sequences B7PDZ4
6945.ISCW018183-PA ISCW018183-PA XP_002399572.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]