SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PFU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PFU9
Domain Number 1 Region: 266-533
Classification Level Classification E-value
Superfamily NHL repeat 3.66e-50
Family NHL repeat 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7PFU9
Sequence length 533
Comment (tr|B7PFU9|B7PFU9_IXOSC) Nhl repeat-containing protein, putative (Fragment) {ECO:0000313|VectorBase:ISCW017943-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW017943 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
ARDKEDEAGRLRSWRDSPSASVDDPTATSSRYGGSSFLANRRRAEEDQEESGASRFLSRS
RSSALVEPPEPRQERRKSQQESSTSRTSTSPATSAAALRRSRLARSKSSNEVLPGDLDSP
DEAVPASPSYRSRYKQEPPSTLSRSKSSHAVKDASPDGGDQSGTASSGASSSWAQYLRNK
YGCRTSSVGGSAASGPGGKNVSRSRSSHAVYNRSGSEENSSDDEVPARGRDGSSSRHDGQ
YGGYGFPRSMYLQKRRMQLKIGTRGTEPGCFTWPRGVAVGPDNSIVVADSSNHRVQVFDS
SGRFQHEFGTYGSSEGEFDCLAGVAVNRIGQFIVSDRYNHRIQIFDPSGRFLRSFGCEGR
VDARFNYPWGITTDSLGFIYVCDKENHRVQVFQSDGTFVGKFGSLGSRPGHLEHPHYVAV
SNTNRVIVSDSNNHRIQIFDVNGRSLSTFGSEGSDDGQFKFPRGVAVDDQGYIMVGDSGN
NRIQIFHPDGSFLRAFGQWGSGDGEFKGLEGIAVMPNGSIVVCDRENHRIQVF
Download sequence
Identical sequences B7PFU9
6945.ISCW017943-PA ISCW017943-PA XP_002434071.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]