SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PK29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PK29
Domain Number 1 Region: 101-307
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-42
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 2 Region: 321-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000321
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 3 Region: 73-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000172
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7PK29
Sequence length 384
Comment (tr|B7PK29|B7PK29_IXOSC) Cell adhesion molecule, putative {ECO:0000313|EMBL:EEC06951.1, ECO:0000313|VectorBase:ISCW004127-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW004127 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MPWDYALSPRAASIDCVPRVGGLALPKAGAARSAWNRSAPGMLDRGTLHALVHCQGRDQP
QRQIVHAQDPHRRRSDSATFSCTATNPYGKDSGSSRVIIQEVPDPPEDVRIGETTSSVVS
LIWTAPYSGNSPITSYAIVYQANGKWSGKHDHEPVRRLSVPGGLTTASVTNLQPLTEYQF
KVVANNDIGTSTASKVISVTTNMEAPQEAPSQVSAAALDSNSIKLSWRKPHHDHKNMQIS
GYYVGYKTQGTSEPFIYKTVEADSKGVKEEFIIGGLQKNTKYAIVVQAFNGQGAGPAADE
IVVKTHETDHSPADADRCRNFDAAPVAPPSDSFVSANMSSASVQLRAWSDGGCPIRHFVL
QYKQQNSRDWIMVSNYIVPEQQVP
Download sequence
Identical sequences B7PK29
ISCW004127-PA XP_002409170.1.51680 6945.ISCW004127-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]