SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PKT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PKT5
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-18
Family I set domains 0.025
Further Details:      
 
Weak hits

Sequence:  B7PKT5
Domain Number - Region: 130-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7PKT5
Sequence length 168
Comment (tr|B7PKT5|B7PKT5_IXOSC) Titin, putative {ECO:0000313|EMBL:EEC07207.1, ECO:0000313|VectorBase:ISCW006065-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW006065 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MCEEMLKPAQAKWLRSTSRADAYRRLQLRCKLNGNPIPWVQWYFMGKPIASNARVHIITK
WRRSRLEIKSARRQDSGLYECRAWNVLRKEPSVVAVNVTVRDRIPPPPTPPEPTRSTAST
TTNGRPCPLVSYCLNGGTCIFYEAVKEPVCQLDLHQLQGVTEPIREKI
Download sequence
Identical sequences B7PKT5
6945.ISCW006065-PA ISCW006065-PA XP_002434383.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]