SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PQV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7PQV7
Domain Number - Region: 139-264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00073
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 49-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00525
Family C1 set domains (antibody constant domain-like) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7PQV7
Sequence length 351
Comment (tr|B7PQV7|B7PQV7_IXOSC) Uncharacterized protein (Fragment) {ECO:0000313|VectorBase:ISCW024316-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW024316 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
GPAGLGEAANSGMPRSSGEATSRAEVLAGLKVEYARAYIAAEEPDNDSGPMELLCTVGFK
EYASITWTVNGRPLENFIDRSSLTTIKNEVPVKVSKITINQLERLPSDNGKFIFECTALV
DAQVTKATIALGSIIEDTCTTNGQCEARGASCSEGRCLCKASQPVSLKSKHLTCRAAANL
GWPCDYSEQCSFVQPNSVCSDSLVCICSLGFVRSLDGKICDKLTPGNLIGSACKENADCH
SAGASCANSVCKCTNDTVERGGLCLPLAHLKLGLETLRGTNFLGAEDSIKSIHNDTRFTV
AAAMINDASDKTTASTALSPPPLSGAADSAPTSYLALLSGTLTMIILARGP
Download sequence
Identical sequences B7PQV7
XP_002436149.1.51680 ISCW024316-PA 6945.ISCW024316-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]