SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PQV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PQV9
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7PQV9
Sequence length 116
Comment (tr|B7PQV9|B7PQV9_IXOSC) Secreted protein, putative {ECO:0000313|EMBL:EEC08981.1, ECO:0000313|VectorBase:ISCW005661-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW005661 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MSFTSPSAKFTNNVSFFYLLRNSVLSNSPLNCKEVDCDEVVCSSAACTCGSHKSECGCCD
ICNKCPGETCITIHDDLCQEGYECKLKDPAGNIFGGDPGSCVPKTETPHDPAQNHT
Download sequence
Identical sequences B7PQV9
XP_002436151.1.51680 ISCW005661-PA 6945.ISCW005661-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]