SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PSS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PSS9
Domain Number 1 Region: 63-227
Classification Level Classification E-value
Superfamily L domain-like 4.12e-24
Family Ngr ectodomain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7PSS9
Sequence length 229
Comment (tr|B7PSS9|B7PSS9_IXOSC) Leucine-rich transmembrane protein, putative {ECO:0000313|EMBL:EEC09651.1, ECO:0000313|VectorBase:ISCW006898-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW006898 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MMLTVARKTTSRFKTTCPVLYHCSCYIYRNKAVVKCPGGRKQSLNADQLTSDLARFASTE
MDEVTVDHFRFTTLPANLARNLTMTSLIITNGPLDAMDDECFEGVLAMDKLIVERTKLKM
VPGAVLRLGSKLRELRLANNSIESVGDVLRTLVNLEKLDLDSNAIESLDESLFNNLGLLK
ELRLGNNKLHRLPIESLKIPPLEIVELHNNALTEETANAFGSFHRLKVG
Download sequence
Identical sequences B7PSS9
6945.ISCW006898-PA XP_002402934.1.51680 ISCW006898-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]