SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q0E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Q0E4
Domain Number 1 Region: 146-205
Classification Level Classification E-value
Superfamily E set domains 0.00000000227
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 2 Region: 297-372
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000288
Family NHL repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7Q0E4
Sequence length 393
Comment (tr|B7Q0E4|B7Q0E4_IXOSC) NHL repeatcontaining protein {ECO:0000313|VectorBase:ISCW020206-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020206 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MGEDDDGIRHLRSLRKMLYIQKDEAYAQIKQEVADLQQKLLKQLDTAFEIKLVELKKLEE
KVQSCSLSLNPLHFFSSIAVKSLLSLDCLKVSDFECTSFAYINACEAKPDQLHFVDDYSA
RVSNTGDTVRVYYMCSLDYDPVLFKFLTVLVKDAANNDISLKHCDLGNGCYMLEFRACEE
GSFLVCVKVYGQNISGSPVVISIQNGDSVLLPELSRSDIQGDDSGFPFELTQSGMEVTLP
ELSQTCVEVTLPKLSRSCVKRRMARKGKSALDHEEVVQGTVSADLVLEFKAYSKNDYLNF
PIGVTATSGGNIIVGDTGNHRVIVFNAEGRPLCKAALPGTVRFRRPSAVVALDDGSFAVK
DDRCVYLFSKAGEYIRTLGKDSLVRPFGKLAYE
Download sequence
Identical sequences B7Q0E4
ISCW020206-PA XP_002407473.1.51680 6945.ISCW020206-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]