SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q1A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7Q1A7
Domain Number - Region: 98-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Q1A7
Sequence length 390
Comment (tr|B7Q1A7|B7Q1A7_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC12629.1, ECO:0000313|VectorBase:ISCW009484-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW009484 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MISLEALLNNITVRAVLTYGSRPRLRHDERDWDWGSTFAVNTSSVGSATAEIHLPYPEAG
LWYLGLLPLCYLEDRRNASVPDWVPCEYESLSVELSINSSACLNQKCGLFGRCFQYISGG
IIFSSCYCSSGYRGWGCTDSTEAQSYNHMLIELLLLTLSNLFFLPAILLAVIRRHFLEAL
VYTATMFSSAFYHACDADLSVICVLRPSVLQYCDFLTATVSLWVTLLCLADLSAPARTLV
STFGVLCIAIAVENDRMGLIVIALPVAFGLTLVFVSWMRQCFVRRSCFPRSKIWLLSIVP
GAALAVIGVVLYTGFETRRNYAYVHSAWHALVGLSLFVVLPGRRKSLDGDLKPDPINPCS
YVRVEELSDMTPTPEPASTARSQLVPPGTA
Download sequence
Identical sequences B7Q1A7
6945.ISCW009484-PA ISCW009484-PA XP_002409186.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]