SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q1Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7Q1Y1
Domain Number - Region: 10-86,230-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00424
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Q1Y1
Sequence length 247
Comment (tr|B7Q1Y1|B7Q1Y1_IXOSC) Zinc finger protein, putative (Fragment) {ECO:0000313|VectorBase:ISCW020547-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020547 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MKAPRARVFCSECGTNQCEACELLIHEEPRFRHHQDRSPLEPPDPFLLCQGAHCSAENLA
DLRCQTCQRSLCYACDQREHLVNRKLAHTKTRFQHYLERLQREEEEEEEYLSADGSFTEA
AMMSLQLMGPDILSDARSLEAQENRKAPRPSSFLLVDDKEVLQSIDAFSALDYVGIQTKQ
LPTCFDGLREVVEKIVDNSTVRSARPVEVIFQALRLLNEKFSGDIDRSIPSSFPDQFFTC
QCTCIAC
Download sequence
Identical sequences B7Q1Y1
XP_002410245.1.51680 ISCW020547-PA 6945.ISCW020547-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]