SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q2M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Q2M3
Domain Number 1 Region: 50-156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000364
Family MAM domain 0.011
Further Details:      
 
Domain Number 2 Region: 167-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000411
Family MAM domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7Q2M3
Sequence length 230
Comment (tr|B7Q2M3|B7Q2M3_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC13095.1, ECO:0000313|VectorBase:ISCW020628-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020628 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MSAGGYIFFETSFQSSPGPSIVSGPEATSPGAGDATAPTVMPTTRAPETPQLYYESVVLA
TRNITPTGPQGFCVSFFYALEGLSVDRLKVVIMDAATTANITVWESQDNYDGRWTKGEVA
YTYGDVHQIWFEAVPKRRGDPARKFRGYIGLDDILFDRMEEAGDNCLGHCTFEGGYCGWQ
NADTDDDFNWEQGRGSQSFLTGPSRDYSSFGKDEMTGFNDVSPVQWSVVF
Download sequence
Identical sequences B7Q2M3
6945.ISCW020628-PA XP_002410903.1.51680 ISCW020628-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]