SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q2M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Q2M4
Domain Number 1 Region: 54-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 225-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000949
Family MAM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Q2M4
Sequence length 403
Comment (tr|B7Q2M4|B7Q2M4_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC13096.1, ECO:0000313|VectorBase:ISCW020629-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020629 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MFKYRPRLDSLRTSAQLMLEATVGANSLGNIAIDNIAFRVGTCPISPQTAARNSGDCNFE
EDACGWTNPHPADGLDDLDWARQYSYGLNGPPADHTKRKPDGYYMNLASSGHLPQRGGSK
AWLLSPKLGPDMTLPRCLSFSYYMYERTIDPAGPSLGSLRVHVLRDAAPGLFSLQTVWRL
NNHQLPDGAPIGEPYQVVLEGIWGHGRVGYVAVDDVSFFDGDCNSECSFERDMCGWTNAT
GVDAAPSTNLVGRAGSVPRDSLTWRLASVVSRPANLQDHTYRAPTGYIFFDIFNQNSVQN
PVLRSTPIAAADGETERCLSFWFAPFGRGESSTLSVFRAAEAPPAGEEPAAASSNGNGAA
PRVLIWRLSTRRMDTSRPDWRYGQVKVPVDAPFKARNNGWPPL
Download sequence
Identical sequences B7Q2M4
XP_002410904.1.51680 6945.ISCW020629-PA ISCW020629-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]