SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q2R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Q2R1
Domain Number 1 Region: 395-611
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-39
Family Laminin G-like module 0.00084
Further Details:      
 
Domain Number 2 Region: 610-797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-33
Family Laminin G-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 175-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-30
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 15-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7Q2R1
Sequence length 820
Comment (tr|B7Q2R1|B7Q2R1_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC13133.1, ECO:0000313|VectorBase:ISCW020670-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020670 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MVAAGSSFAGGTICECRVDGPCQQICFDLHDGTFECGCSSGYRLSSNGYGCEQYDNGIDV
MLSDDPGRSPSGSRVTERKRTPKSRDDSWPDLSWAEEDASWEISRRRRTGPSDGDSVDAD
EDDDPSGRYESPLNTVAATTTAATSPHDGVAGPAAESCDVLACSPEGRCVQDERRGGVRC
ACSLGTGGPFCDQELELRHPRFSGASYLALPTLRDAHKSMQVSLQFRPETHDALLLYSGE
TPELLGDYFAIVLDKGFVEFDCGMGQGILRSDQPVLLNAWNTLTVYRDRWDAWMQLNSGH
QVQGRSKGLFSRITLRLHVYLGGSPNASLAAGRLGTREGLVGCVRRLEINGRRYDFRTGG
RGDAIGGIDVDDCGGDACSHVVCQNGGQCIATGTERGVCLCALGFAGSSCETPVDIVVPS
FNGSSYLRFSGLGNAHLSFLDVQVAFKPLSPHGVFFYNGCKMDGTGDFVALQMANGYVEF
RFDLSSGTAVLRQAHTLLPKLSSSASPVALGEWHTARASRTGRLGSLSVDEQPRVEAHSP
GAFTQLSLPLNLYLGGVPDPGETAAGAAVLQSFVGCVQRLTINNRPLRLMQEALSGVNVA
NCVHPCVTGPCYNGGACQPRMDLYSCHCKLGYAGSNCQTELGFADLTPSPLSRAGQRLYR
IRGDRLEVQLAFRSFSSHGLLLWAGDAEQRPASDFVSLGLEKGQLTLRYNLGSGEAALTC
NASRVDDGRWHWAHLSRSQQAATLALDKSAPVAVSAPGRLRQLNVHSGLYVGGVGDVSHV
TRGRYKSGLVGCVANLTLATDLHVRLVSHAATGINVQPCL
Download sequence
Identical sequences B7Q2R1
6945.ISCW020670-PA ISCW020670-PA XP_002410941.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]