SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q7L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Q7L6
Domain Number 1 Region: 150-293
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000629
Family Fibronectin type III 0.0081
Further Details:      
 
Weak hits

Sequence:  B7Q7L6
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000213
Family Fibronectin type III 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Q7L6
Sequence length 319
Comment (tr|B7Q7L6|B7Q7L6_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC14838.1, ECO:0000313|VectorBase:ISCW010901-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW010901 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MLDTYLVRCCVERESKCVEVETTNNSVMVSNLYADTVYTVYVGAVLMGLGWGKNDIARSS
RGPGTQQRREGDGSKADGNGIPGGCGAPPKPTSTHRAMRNPPQVTARVCAGGRTFPVPAS
PSIEFIGNNARTSVFTWNFKDTEMIYIQVSLDNSTWLNCSVEADKCRISRLTESTLFDSS
GITTINDLAPGVTHTVFLRGCNFLGCGMSNSSEVHVPELVPRDPTNVTFTVLPNNTAVVK
WIGHSTLWDSSPPYDVTWKCGNGPKMVMITTLNTLSIHDFIDADCQVWVTAVSSWRDLYV
HRSQEVRAVVQNDQYSKES
Download sequence
Identical sequences B7Q7L6
6945.ISCW010901-PA ISCW010901-PA XP_002404189.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]