SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7Q7N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7Q7N1
Domain Number - Region: 42-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000384
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7Q7N1
Sequence length 254
Comment (tr|B7Q7N1|B7Q7N1_IXOSC) Secreted protein, putative (Fragment) {ECO:0000313|VectorBase:ISCW020889-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020889 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
CLIALSNVALLLLLPSVSASADFRFPDYRRLICAGFIQLSDQSCSTGWNCYRFAKGSFCQ
DGFCVCRFGYSFGLRNGRLQCVGGLTFGESCSDQRPCSTISRTFCYNGSCLCEEDYVFYE
DRCERQAMFSKHDVDSYVSPPTRFNLLTILIIVAILVVALLFLVNKRSLFFYFPCCMRDT
VNIPGILQAESGASTNHPVNAGILGTTLSPRICVFGKSMWNLYKPPSYMETVLNVQYLPS
YQEAANLPPSPKPS
Download sequence
Identical sequences B7Q7N1
XP_002404226.1.51680 ISCW020889-PA 6945.ISCW020889-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]