SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QHI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7QHI4
Domain Number 1 Region: 64-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.81e-23
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7QHI4
Sequence length 130
Comment (tr|B7QHI4|B7QHI4_IXOSC) Alpha-actinin, putative {ECO:0000313|EMBL:EEC18306.1, ECO:0000313|VectorBase:ISCW014889-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW014889 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MLPRHFIVSDVTSGLRVFPRAEPPKNAFAKFQQMDSSANRGRPAAAPNFRGGSGGVARSA
SDIKEMLLSWCKNKTRGYANVDVQNFSTSWNDGMAFCALIHHFYPEAFDFDQLDPKNRRH
NFDLAFRTAE
Download sequence
Identical sequences B7QHI4
XP_002414641.1.51680 ISCW014889-PA 6945.ISCW014889-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]