SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QHQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7QHQ8
Domain Number 1 Region: 454-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000989
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 2 Region: 343-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000518
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 422-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 4 Region: 302-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 382-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7QHQ8
Sequence length 821
Comment (tr|B7QHQ8|B7QHQ8_IXOSC) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW013622 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MTGDANASGVFELQLRAFSNLLSQDSRGSCCSTGLPPSPGAPCPGTCRTWFRVCLKHYQK
TVDTNSPCTYGEVQTPVVASSGPGSTLNLTAPVRFSFDFSWPGTFSLIVEAWHENSNGGE
GEAAFAAGNSVGELVCLGGSERACVVWRRRQQPSDPGVASDDAALAQRGPGLDLGYFAVG
ADVAVFSFRVVCEEHYFGADCARLCRPRDDKFGHYACNAKGDVVCLPGWRGDYCSKAICL
PGCKEPQGDCDQPNECKCRIGWEGPLCDRCTRYPGCLHGSCQQPWQCNCDEGWGGLFCNQ
DLNFCTNHRPCQHGGTCTNTGQGSYTCACPPGFTGKDCEVAQDPCRASPCRNGGVCENGD
GSYRCRCPPGLTGRHCETAESACAAGPCEAGGTCLEDPRSAQDGVAPGFRCLCTDAFTGD
RCQIQREPCEPSPCANGGTCTTLPDDSREGFRCTCRPGFAGPRCEVDVDDCASRPCANGG
TCVDGADSYRCLCVPGFVGPRCRTDVDDCLTLPCSNGGRCVDLVNDFACRCPPGFSGKDC
SVSLDECDSSPCLNGGTCVDGVGRFACRCLRGFSGSRCEYGPGSAAEAPPRPVAGSSARH
GPFVATERVGNVVGQDNEDRLTGAHVALIAAFSVAVPVAVLAAALAIVCFRRRRRWREQR
DADAVLRQNEHNATHHSMNNKLGGGQVVVNELEKPLQKKQANRVDDGKGGKGGVAVSSAP
PNNKVLNVECASARSSKLFDAGEGGVYASTRTLNRLHVAAGGEGSSAAGTPAMSPSKSCD
LPTNEDDSTSESKEHHPQTGSSVVYVIEEHYKDDSLLATEV
Download sequence
Identical sequences B7QHQ8
ISCW013622-PA 6945.ISCW013622-PA XP_002414716.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]