SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QM60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7QM60
Domain Number - Region: 54-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.002
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7QM60
Sequence length 163
Comment (tr|B7QM60|B7QM60_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC19932.1, ECO:0000313|VectorBase:ISCW014968-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW014968 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MEVTRVNCVIRLYTNGDEKPSGGVTLQADAGRTTQGPLHLTLGAPCAFNRQARCVTEDSD
CDRTRNPAVCACREGFRFIPEVLILFVRDCSDGYYIVDGHCVPGQTSKWPSVRASSMAKL
VLSLWYSIAVIALGIWLYHHSHSPSLVYERSVTTWEFLPKMEH
Download sequence
Identical sequences B7QM60
XP_002416265.1.51680 ISCW014968-PA 6945.ISCW014968-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]