SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QM61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7QM61
Domain Number - Region: 15-43
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00463
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7QM61
Sequence length 176
Comment (tr|B7QM61|B7QM61_IXOSC) Uncharacterized protein {ECO:0000313|EMBL:EEC19933.1, ECO:0000313|VectorBase:ISCW014969-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW014969 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MLGQPCRRDEQCHKIDKHADCDDGYCKCEDGYYLFHDINGTSCLQDQELQTIRPFGADRK
SESISEENMVPIIVCLAIMFVGMCVALQLFSRARFRNQRTIFNTPNARLTPLKLGSGKRG
KRRASHVSLPGGSRRPSACSQLSPSRAGYVYAPTETNTNKGTERSACPCPFVFVFV
Download sequence
Identical sequences B7QM61
ISCW014969-PA XP_002416266.1.51680 6945.ISCW014969-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]