SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QMY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7QMY8
Domain Number - Region: 156-210
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00183
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.033
Further Details:      
 
Domain Number - Region: 81-222
Classification Level Classification E-value
Superfamily NHL repeat 0.034
Family NHL repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7QMY8
Sequence length 226
Comment (tr|B7QMY8|B7QMY8_IXOSC) Lyst-interacting protein, putative {ECO:0000313|EMBL:EEC20210.1, ECO:0000313|VectorBase:ISCW015508-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW015508 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MKKYSQVNARSLDASKTSRGVTAARKSQSVQIRSSAATREKSKEGNSSRTWALDSKGHRM
FLTIVSKEIDPFTQVIIYTFQNGDKKDLYPDGKVVYHYAKSQTVHTVYPSGKKEIQFANG
QRELHGKDGNIEVTYPNGTIRRVFSTGEEEQEAPDGTVARRLRDGTEIVHYPNGQKEVRH
ESYRSRSYPNGTVKTIYPSGKQITKYSNGKVRVKDANGTVLVNTSS
Download sequence
Identical sequences B7QMY8
6945.ISCW015508-PA ISCW015508-PA XP_002400414.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]