SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7UIQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7UIQ2
Domain Number 1 Region: 70-294
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.61e-48
Family Dienelactone hydrolase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7UIQ2
Sequence length 295
Comment (tr|B7UIQ2|B7UIQ2_ECO27) Predicted hydrolase {ECO:0000313|EMBL:CAS10834.1} KW=Complete proteome OX=574521 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC). GN=E2348C_3286 OC=Enterobacteriaceae; Escherichia.
Sequence
MPRLTAKDFPQELLDYYDYYAHGKISKREFLNLAAKYAVGGMTALALFDLLKPNYALATQ
VEFTDPEIVAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVVHENRGLNPYIEDVARR
VAKAGYIALAPDGLSSVGGYPGNDDKGRELQQQVDPTKLMNDFFAAIEFMQRYPQATGKV
GISGFCYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIEAPLLLHYAELDSRINEGW
PAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADLAWQRTLKWFDKYLS
Download sequence
Identical sequences A0A0V9RHN4 B7UIQ2 E3XTW2 H4IGA9 H4IX12 H4KLW9 H4LH43
574521.E2348C_3286 gi|215488325|ref|YP_002330756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]