SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7YZJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7YZJ0
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7YZJ0
Sequence length 789
Comment (tr|B7YZJ0|B7YZJ0_DROME) Mbl, isoform J {ECO:0000313|EMBL:ACL83142.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG33197 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYD
SIKGRCNRDKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAV
ATNPYLTGIPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEQ
FSGMVPFKRPAAEKSGIPVYQPGATAYQQLMQPYVPVSCIINAVMASTNITSSATTTASS
SLLSALGTPPTTTTTAITNPNDSDNDSDRNQDHDKNHDSTADGEADNADRNDAIDQVSNQ
DNSDQVNLNQNQQNSSPAKDCNTTRTISPNPQDTAATAATATETDTLDTESAAAAAAATS
ATHPPGDTPPPCQRSPQGDSLLPLPNGLGDNNNYLSYINNNLNNGQLKSANPEELNGGDL
ESSSNNAAAAAAASASASRNYAKQNGEGYSRYMVNGHSTGILPTPTTSAPAVSYQAQAQA
QAQAQVQAQAQAQAQVQAQTQQRINYAMSAYGNLYSHYGAPTSAMVSLPSSTPSYAQAQM
QQQQQQAQAQAQAQAQAHAVYAQQAYAAYAAAGLAPQATATGSYYADPAALAKEVAQKNY
AMKLASAGTKPGVSSAAAAYTGLTLNKSYVAAAAGAQPVQPAQHQAVSMATLLQMQAQAQ
AQAAQVQAQAQAQAQAQAQAQAQAQMRQLGSLPSSGLATPVPGTPVRAPVGASQYQSATL
LRAPSPMPYAQPQSYFYPGMMPTAAYAMPQTQAAAAQQYAAAAAAAAAAQAGTPGSAMVL
NPYKKMKTS
Download sequence
Identical sequences B7YZJ0
FBpp0297558 NP_001137688.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]