SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7YZR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7YZR7
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily L domain-like 4.08e-29
Family Internalin LRR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7YZR7
Sequence length 261
Comment (tr|B7YZR7|B7YZR7_DROME) Mapmodulin, isoform B {ECO:0000313|EMBL:AAF57777.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5784 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLP
NLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDA
TQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDS
DEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKD
KDGEKEADESQVRGKKRKHDG
Download sequence
Identical sequences B7YZR7 Q9V895
FBpp0086001 FBpp0086002 FBpp0086001 FBpp0086002 NP_523780.1.81976 NP_725732.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]