SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7Z4W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7Z4W5
Domain Number 1 Region: 101-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.02e-107
Family AAT-like 0.000000000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7Z4W5
Sequence length 516
Comment (tr|B7Z4W5|B7Z4W5_HUMAN) cDNA FLJ56468, highly similar to Kynurenine--oxoglutarate transaminase 1 (EC 2.6.1.7) {ECO:0000313|EMBL:BAH12701.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_30593 OC=Catarrhini; Hominidae; Homo.
Sequence
MFRTAAAISVHLVGPLQGRKAGAPLTWFLHQTQVAEKNVGSPAPRPTSHLGLANPQERKV
PQGPQSPCEVPAAEGILRTGGAKLPIQGHPAKLAMAKQLQARRLDGIDYNPWVEFVKLAS
EHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQ
EIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKP
GPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQH
DVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIM
KHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQS
VGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYS
VPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Download sequence
Identical sequences B7Z4W5
NP_001274319.1.87134 NP_001274319.1.92137 XP_016870750.1.92137 XP_016870751.1.92137 ENSP00000399415 ENSP00000399415 ENSP00000412402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]