SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7ZCR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7ZCR6
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000402
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 698-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000211
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 467-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000258
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 4 Region: 516-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000355
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 606-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000105
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 761-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000029
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 560-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  B7ZCR6
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0179
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7ZCR6
Sequence length 869
Comment (tr|B7ZCR6|B7ZCR6_MOUSE) Zinc finger protein 512B {ECO:0000313|Ensembl:ENSMUSP00000104417} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Zfp512b OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTESFCVGGGRRLQGSSKSGPGKGGSRKEAQLPLLQDPPKLGMPVVHSGHTVPSQAPLCF
DPGNSASDKTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDHPLPAPKPGPVSRP
VTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRP
VPVTKPIPITKPVPLTKHMPVTKLVTVSKPVPLTKPVPVSRPIVVSKPVPVSRPIAISRH
IPPCKMVLLSKSENKTLRATGKNSNKKRAADSLDTCPILSKQARPENGAYGPSSMDQSVT
FPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGL
KGLAKAEDKARVHRSKKQEGSGSEEVRKKVLATPVTVSKEAPTPVAHPAPGGPEEQWQRA
IHERGEAVCPTCNVVTRKTLVGLKKHMEVCHKLQEALKCQHCRKQFKSKAGLNYHTMAEH
SAKPTDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPC
EVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEDPTDKIPEAEDLLGVERTPSGRIR
RTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNE
VKEKGHVNCPNDCCEAIYASVSGLKAHLASCSKGDHLVGKYRCLLCPKEFSSESGVKYHI
LKTHGENWFRTSADPSSKHKSQDSLMPRKEKKKSLSGGKKRGRKPKERSSEEPASKLPPN
RDDWPPGGRDRGSRSSTGKKAGAGKAPEK
Download sequence
Identical sequences B7ZCR6
ENSMUSP00000104417 NP_001158069.1.92730 XP_006500710.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]