SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7ZRP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7ZRP5
Domain Number 1 Region: 258-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-83
Family Protein kinases, catalytic subunit 0.000000000615
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-40
Family SH2 domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-27
Family SH3-domain 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7ZRP5
Sequence length 537
Comment (tr|B7ZRP5|B7ZRP5_XENLA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18029264mg OC=Xenopus.
Sequence
MGCVQCKDKEATKLTDERDNSLTQSLGYRYGTDPTPQHYPSFTVTTIPNYNNFHATAGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLNFQKGEKFQILNSSEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFEALQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences B7ZRP5
NP_001080120.1.7800 gi|148226967|ref|NP_001080120| gi|213623802|gb|AAI70239| gi|27694619|gb|AAH43749|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]