SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7ZS88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7ZS88
Domain Number 1 Region: 339-527
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-64
Family Regulator of G-protein signaling, RGS 0.0000109
Further Details:      
 
Domain Number 2 Region: 732-960
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-59
Family DBL homology domain (DH-domain) 0.0000000118
Further Details:      
 
Domain Number 3 Region: 962-1095
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-40
Family Pleckstrin-homology domain (PH domain) 0.0000052
Further Details:      
 
Domain Number 4 Region: 45-132
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-22
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7ZS88
Sequence length 1431
Comment (tr|B7ZS88|B7ZS88_XENLA) Larg protein {ECO:0000313|EMBL:AAI70436.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=Larg OC=Xenopus.
Sequence
MSGTQSAASDRFHSRKPTRHGSILYRESSTDKKQKVERSVSSSHDFDATGLVQRCVVIQR
DENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSG
SYVALTVQGRPPGSPTIPLTDSEADNFVPIMPPHSPVPQGHGKGITSPILMEEENNIVHT
QKLDILMKMLQKEQDQLHQFQEEFHTTPSQRLSKEIQDSKKHIAQLQDGLSKARGLSQGS
ESLQISELDADSSDILGQTDCSSGDGSRPNSDIVDSPRSGQRDKSFLEESLEKSEIQDTD
SQSSMGSPSIRFTHNIIGAEDDDFDAEPEQSPQINGQCSCFQNMDLLKSHPAHLAVFIHH
VVSQFDPAALLCYLYADLYQQTNSKETRRVFMEFNQFFLERAANLKVPVPDDVALELEKR
RPELIPEELHRQYIQTVQERLSEDVKKNLEDFKQKRSMGLTLAEGELSKLDTERFRDRNT
IDKERACAEQIVQKIEEILFTSQTPEDEKSNTIQYVILTYMKHLGVKVKEPRSLEQKRGR
IGFLPKIKQSMKKDREGEEKVKRRGFPSILAPQRKPSRQDSNAIGKAMELQRQRHPKHLS
TSSSSSPEPADGSRLRTSGGSIEGSDTPFSPSSNLGAAYTFQEVGREVEGVSRCGGENMS
SVDTLDGGTRTSGPIFDFPSPSLDHLHEEIGEADRLTDLGTPKLLRKLDSVALSDIQSED
EHHEIDQEQDPPNWQQLVSKDTLQKLKPHEIKQQEVINELFCTERAHVQKLSVLDQVFHQ
RVIRENLLTPAETRNIFSNLEEILQLHGALNEQMKAVKKRYETSVVEEIGDYVLNWFSGA
EEEKLKQAVATFCSNQPFALEMIKSRQKKDLKFLAFVQDAESNPLCKRLQLKDIIPTEMQ
RLTKYPLLLDNIARYSDQEDEKEKVNKAANHCRNILDYVNQAVKEAENKQRLEDYQRRLD
LSCLKPGEYPMIDELRNLDLTKRKLIHEGPLTWKVNKDKSIDLYSLLLEDILVLLQRQDD
KLILRCVSKILAATSESKHIFSPVIKLNTVLVRQVATDNKAFFVISMSENGAQIYELMAN
SVSEKNGWQDLITSMAATSKTENSQPAQLQQTDPDLDSEEEHEDQQKLSNDKEDERLLHR
HRTDKDTESLVQPKSFSPSPTHGSILPHHAGILKDQNQQDFRCSTSPSSCHPSTEHHLAV
HALRNLGLLKQLLEQQLKFLQKEEEENFQRFCSHKTKEQNLTRVSSLNKQNRGSRESDLN
KDLHALHRAIDKGSEHGNTGPDCVAEILEESGEQFFDAQEPHSDIYVDGSRREKHIEEAQ
FRSSENYLILDGYENVPESSTDDDLSASHYSNQGDPNDSLHGEERLAFNALEPASSSEAF
DQMLHYIETIESDLQQLKGLEDHYITYRNRVALSGVLEEDPDKAMLPTDKG
Download sequence
Identical sequences B7ZS88
gi|213626350|gb|AAI70436|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]