SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7ZUD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7ZUD8
Domain Number 1 Region: 278-517
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-60
Family Nuclear receptor ligand-binding domain 0.00000000347
Further Details:      
 
Domain Number 2 Region: 165-244
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7ZUD8
Sequence length 548
Comment (tr|B7ZUD8|B7ZUD8_XENTR) Estrogen receptor 2 (ER beta) {ECO:0000313|EMBL:AAI71194.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=esr2 OC=Silurana.
Sequence
MSTYMHKEYSQLQPMQHILHGKADIKSSPSAINSSVPYSGTVPMDQSPMYTPSSYLDSRH
DYPSITFCSPSLINYNVPGSDSESSVLRQTVSPGLLWTSPDHMSPVTLHCQSSLLYTEAP
TSPWFEAKSEEHILPLSRESLKRKSMGSECANNVGSNPGSKRDTHFCAVCSDYASGYHYG
VWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCFEVGMMKCGTRRE
RCGYRIVRHRRHSDDQMHCLAKNKKLTDNIQRVKEISASSLGPEQFVLIISDAEPPNVML
MNRLCKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWLEVLMM
GLMWRSIDHPGKLLFAPDLTLDRDEGKCVEGILEIFDMLLATTSRLRELKLQHREFLCLK
VMILLNSHMFPLTSSEEESESSRKLHHLLNTVTDALVWVIAKSGIPFRQQSTRLANLLML
LSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRDHRKSTLAISNYSSKAESEA
RDAGQPTQ
Download sequence
Identical sequences B7ZUD8
gi|213624505|gb|AAI71194|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]