SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8A565 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8A565
Domain Number 1 Region: 42-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 2 Region: 101-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000295
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 631-673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000301
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 579-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8A565
Sequence length 673
Comment (tr|B8A565|B8A565_DANRE) Complement component 9 {ECO:0000313|Ensembl:ENSDARP00000121323} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=c9 OC=Cyprinidae; Danio.
Sequence
MKALAALCVTICLLYQANGKSITDPVQGSRREVRQINDPPPVDCKMSAWSQWSPCDPCTN
TTYRSRSIEVFGQFKGTVCSNPIGDRRLCVPKTKCQMDDPPVCKSSQWQCTFTRMCINKN
LRCNGDNDCGPTDESDEEDCDVIRSPCGKTAVFESDIALKAGYGINILGSGPRNNPFDNK
VYNGQCNRIRDPNSMEYNRLPWNVGVLHYETKVEESSSKEMYEDIHSLIKEITRETSSTF
EIGLNFKFTPTETSKNDEGGNAGSAGEGGNAGSAGEGGNAGSAGEGGEVASPNEGGAAAG
PVEGGGGEGPATSGGAGVGGDPGVSGGIPDAAPGFGISGSAGANYKQTTTNIIKQLSELT
TTKRKTFMRVKGRVELATYRMRQRGLEVSSTFLDDVDALPLQYEKGQYFSFLEEYGTHFT
KNGKSGGEYQLVYVMNEDIRKQKHVTEATVKKCFELGLKADFQLTPAAEGGGEVKPLNDC
NSLTNTDTDEKNNKGVIDKVLIEVKGGSAASAVAMKSQLTKDGILDYNQYVEWAKTITIL
PALIQSEPEPIYNAIPLSFPDAQPRRDNLKRALDEYVAEYSVCKCQPCQNGGTVIQIDGQ
CKCMCLPGSEGVACQIIDMEMMKGKTFEQLGNWGCWSAWSHCSGGRRTRSRSCNNRGLTN
GICKGDKTSEDYC
Download sequence
Identical sequences B8A565
NP_001314855.1.45394 ENSDARP00000121323 7955.ENSDARP00000103915 ENSDARP00000121323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]