SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8AJ36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8AJ36
Domain Number 1 Region: 70-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-68
Family Glutathione peroxidase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8AJ36
Sequence length 263
Comment (tr|B8AJ36|B8AJ36_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC73346.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_07554 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAACCSSLATAVSSSSAKPLAGIPPASPHSLSLPRSPAAAARPLRLSASSSRSARASSFV
ARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI
TAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSF
GVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPA
GWKPGDKSMKPDPKGSKEYFAAI
Download sequence
Identical sequences A0A0E0G7U2 B8AJ36
39946.BGIOSIBCE007314 OsIBCD006751 ONIVA02G21520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]