SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8ALD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8ALD1
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-30
Family Thioltransferase 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8ALD1
Sequence length 134
Comment (tr|B8ALD1|B8ALD1_ORYSI) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_13929 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGSFFSTMFTPPPAADDGGDSRVVAVHSTATWDEQWGAHKSNPNKLIVIDFSATWCGPCR
FIEPAFKDMAGRFADAVFFKIDVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDE
LERKVNMFISSSSS
Download sequence
Identical sequences A0A0E0GV23 A0A0E0P2N0 B8ALD1 Q851R5
ONIVA03G39070.1 LOC_Os03g58630.1|PACid:21917582 39946.BGIOSIBCE013316 39947.LOC_Os03g58630.1 OsIBCD012287 OMERI03G34320.1 LOC_Os03g58630.1|13103.m06438|protein XP_015631704.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]