SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8AM97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8AM97
Domain Number 1 Region: 138-257
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-32
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8AM97
Sequence length 281
Comment (tr|B8AM97|B8AM97_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC76407.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_14057 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MSGLYSPGFSPARNLSPQIRSNPTDVDSQYLAELLAEHQKLGPFMQVLPICSKLLSQEIM
RVSSIVHNHGFGDFDRHRFRSPSPMSSPNPRSNRSGNGFSPWNGLHQERLGFPQGTSMDW
QGAPPSPSSHVVKKILRLDVPVDSYPNFNFVGRILGPRGNSLKRVEASTGCRVFIRGKGS
IKDPGKEDKLRGKPGYEHLSDPLHILIEAEFPASIIDARLRHAQEVIEELLKPVDESQDF
YKRQQLRELAMLNSTLREDSPHPGSVSPFSNGGMKRAKTGQ
Download sequence
Identical sequences A0A0D3FQL4 A0A0E0GVI7 A0A0E0P315 B8AM97 Q75GR5
XP_015628084.1.37577 OBART03G38700.1 LOC_Os03g60110.1|13103.m06598|protein ONIVA03G40350.1 39947.LOC_Os03g60110.1 LOC_Os03g60110.1|PACid:21916489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]