SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8AUF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8AUF6
Domain Number - Region: 39-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0537
Family Glutathione peroxidase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8AUF6
Sequence length 88
Comment (tr|B8AUF6|B8AUF6_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC78016.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_17429 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGEPIVAVAIAMNEAGDDGASMEKKVIYLHLIVLSKLRFTLTDVQTPDPWAYAEKLGHVS
MLMNWCSVCKCQQEQPFLQTHKDSSKTK
Download sequence
Identical sequences B8AUF6
OsIBCD015615 39946.BGIOSIBCE016613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]